Young woman with fresh pitahaya in kitchen. Exotic fruits
Stock Photo ID: 694348
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Young woman with fresh pitahaya in kitchen. Exotic fruits”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.You may use our image “Young woman with fresh pitahaya in kitchen. Exotic fruits” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Keywords
adultantioxidantbackgroundbeautifulcaucasiancutdeliciousdietdietarydragoneatexoticfemalefoodfreshfruitfruitsgirlhalveshappyhealthyhomeindoorsjuicykitchenladylifestylenaturalnutrientnutritionnutritiousorganicpersonpitahayaportraitproductripesmilesmilingsnacksweettastytropicalveganvegetarianvitaminwomanyoungyummy
Create memorable and engaging creative projects with Africa Images
Our goal at Africa Images is to create and supply exceptional stock images that will enhance your brand’s reputation. If you are a business owner or marketer, you understand that your advertising efforts require high-quality photography that can be used royalty-free in your creative campaigns. We can provide a range of sizes and resolutions, alongside a huge supply of themes and collections to ensure you find the perfect image. With additional benefits and service features, including free images, sharing previews, and unlimited downloads, now is the ideal time to enhance your brand visibility, drive engagement, and ultimately boost your sales.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Transform your projects with creative imagery collections
Enhance your creative work with a huge collection of stock images that more than stand out from the crowd. There are a number of thematic categories, depending on whether you are looking for ordinary, everyday lifestyle pictures or something a little more different and unique. Regularly updated to stay current and relevant, our engaging image collections showcase modern and trending photos, including interior designs, happy families, holidays, fresh foods, and more; only the best visuals are selected and made available on the platform. With this high-quality photo stock, every picture can transform uninspiring and plain creatives to compelling visual stories.
Get additional benefits beyond quality images with our photo stock
Have a taste of innovation with our premium and trusted online photo stock. Creative professionals can stay up to date with the latest trends and popular themes thanks to new images loaded daily on the platform. Filter and download your perfect picture from our free gallery that covers diverse topics, including business, transport, fashion, and much more. In our blog, you will discover best practices in using your new high-resolution stock images in business and creative activities. Choose us for additional services that will elevate your visual experience, going beyond the norm to deliver outstanding results for you and your brand.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s secure and simple to find your ideal image on our website
Don’t you hate when you waste precious time searching online for stock images only to find the quality, user experience, payment processing, and poor customer service? That’s not the case with our photo stock. Alongside diverse image collections, easy website navigation, and payment protection at checkout, our on-demand pack options provide choices depending on your usage needs and, most importantly, cost savings when buying in bulk. Both the Standard and Extended licenses allow for our visual content to be used in digital reproductions, as well as personal non-commercial use. With Extended, you benefit from unlimited use in printed reproductions and outdoor advertising. You can also use this license type if you’re involved in designing business or commercial spaces, as well as in products for sale or distribution and digital templates for sale or distribution.