Female technical support operator talking on mobile phone at workplace
Stock Photo ID: 321476
Large 5506 × 3670 px, JPG 194.24 × 129.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Female technical support operator talking on mobile phone at workplace”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5506 × 3670 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.You may use our image “Female technical support operator talking on mobile phone at workplace” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultagentbackgroundbusinesscallcaucasiancentercommunicationcomputercontactcustomerdeviceemployeeequipmentfemalefriendlyhappyhelphelpdeskhelplinehotlineindoorsinternetmaturemobilemodernofficeonlineoperatorpersonphoneportraitprofessionalreceptionistrepresentativeservicesmilingspeakingspecialistsupporttabletalkingtechnicaltechnologytelecomtelephonewomanworkworkplace
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
When it comes to crafting campaigns, images speak louder than words
Photography is everywhere, and it can make us think, connect, engage, act, and even stop in our tracks. Whether you are a business owner or a content creator looking to elevate your work, we believe that with the right image, you can convey more information than words. This is why we go to great lengths to ensure our photos are of the highest quality, showcasing the diversity of images available but also license options. If you want your audience to connect on a deeper level with your brand, our royalty-free images will compel them to explore further and convert.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a positive buying experience from start to finish
It doesn’t have to be difficult to find quality stock images online. We certainly don’t make it so with our user-friendly website and service offering. Users can select from Standard or Extended license on-demand pricing packs that reduce the price per individual image with the more you buy in bulk. You can compare the two license types to determine which one is needed based on your proposed image use. Some noteworthy differences of the Extended pack are that you will be allowed to use our content on products for sale or distribution, on digital templates for sale or distribution, and on any designs for business or commercial space.