Emotional young woman near open refrigerator in kitchen
Stock Photo ID: 39354
Large 6600 × 4400 px, JPG 232.83 × 155.22 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Emotional young woman near open refrigerator in kitchen”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6600 × 4400 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.You may use our image “Emotional young woman near open refrigerator in kitchen” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultapplianceassortmentbackgroundcaucasiancoldcolorcooldifferentdomesticdrinkeatelectricemotionalequipmentfemalefilledfoodfreezerfreshfridgefrostfruitsfullgrocerieshealthyhomehousehouseholdindoorskeepkitchenlargelifestylemanymodernnutritionopenpersonportraitpreserveproductsrefrigerationrefrigeratorshelvesshockedtechnologyvegetableswomanyoung
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Find the best modern royalty-free image collections here
Use our imaginative stock image collections for inspiration and tell powerful stories. With regularly updated collections and millions of available images to browse and download, you will easily discover your perfect visuals. Discover the latest trending pictures showcasing the opulence of home interiors, the magnetism of a spa, laidback holiday vibes, and the fast-paced world of business. When clicking on your desired category, you will find the photo collections grouped by the same subject. Need to refine your search? Use our search page with the help of convenient filters and keywords. Delve into thoughtfully crafted collections that extend beyond aesthetics, sparking imagination for your campaigns.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.